Western blot testing of 1) rat liver, 2) rat kidney, 3) mouse liver and 4) mouse kidney with Annexin IV antibody at 0.5ug/ml. Predicted molecular weight ~36 kDa.
ANXA4 / Annexin IV Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782778-100
Catalog Number: LS-C782778
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Annexin IV antibody LS-C782778 is an unconjugated rabbit polyclonal antibody to Annexin IV (ANXA4) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 35-beta calcimedin | ANX4 | ANXA4 | Annexin A4 | Annexin IV | Annexin-4 | Chromobindin-4 | Endonexin I | Lipocortin IV | p32.5 | PIG28 | Proliferation-inducing gene 28 | Protein II | ZAP36 | p33/41 | PAP-II | PP4-X
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P09525
- NCBI GenBank
- NM_001153 | NP_001144.1
- SwissProt
- P09525
Target
- Target
- Mouse ANXA4 / Annexin IV
- Antigen Species
- Mouse
- Gene Name
- ANXA4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS