Western blot - Anti-Annexin IV Picoband Antibody
ANXA4 / Annexin IV Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662221-100
Catalog Number: LS-C662221
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Annexin IV antibody LS-C662221 is an unconjugated rabbit polyclonal antibody to human Annexin IV (ANXA4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 35-beta calcimedin | ANX4 | ANXA4 | Annexin A4 | Annexin IV | Annexin-4 | Chromobindin-4 | Endonexin I | Lipocortin IV | p32.5 | PIG28 | Proliferation-inducing gene 28 | Protein II | ZAP36 | p33/41 | PAP-II | PP4-X
- UniProt Number
- P09525
- NCBI GenBank
- NM_001153 | NP_001144.1
- SwissProt
- P09525
Target
- Target
- Human ANXA4 / Annexin IV
- Antigen Species
- Human
- Gene Name
- ANXA4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152 aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl