
Western blot analysis of TMEM16A using anti-TMEM16A antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: human A549 whole cell lysate,Lane 4: human PANC-1 whole cell lysate,Lane 5: human SK-OV-3 whole cell lysate,Lane 6: human SGC-7901 whole cell lysate,Lane 7: human COLO-320 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM16A antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM16A at approximately 130KD. The expected band size for TMEM16A is at 114KD.
ANO1 / DOG1 / TMEM16A Antibody
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TMEM16A antibody LS-C756420 is an unconjugated rabbit polyclonal antibody to TMEM16A (ANO1 / DOG1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ANO1 | Oral cancer overexpressed 2 | Transmembrane protein 16A | ORAOV2 | Anoctamin-1 | DOG1 | TAOS2 | TMEM16A
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q5XXA6
- NCBI GenBank
- NM_018043 | NP_060513.5
- SwissProt
- Q5XXA6
Target
- Target
- Human ANO1 / DOG1 / TMEM16A
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- ANO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
