Western blot testing of recombinant human ANGPTL4 protein (1ng/lane) with ANGPTL4 antibody at 0.5ug/ml. Expected molecular weight: 50-55 kDa.

ANGPTL4 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782817-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ANGPTL4 antibody LS-C782817 is an unconjugated rabbit polyclonal antibody to human ANGPTL4. Validated for ELISA and WB.
Application: ELISA, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Angiopoietin-like 4 | Angiopoietin-related protein 4 | Angiopoietin-like protein 4 | ANGPTL4 | Fasting-induced adipose factor | NL2 | PGAR | Pp1158 | ARP4 | FIAF | HFARP
Recommended Dilution: ELISA: 0.1 - 0.5 ug/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9BY76
SwissProt: Q9BY76

Immunogen: Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS