Western blot testing of mouse HEPA1-6 cell lysate with ANGPTL3 antibody at 0.5ug/ml. Expected molecular weight 50 ~ 63 kDa depending on glycosylation level.

ANGPTL3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782075-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ANGPTL3 antibody LS-C782075 is an unconjugated rabbit polyclonal antibody to ANGPTL3 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ANGPT5 | ANG-5 | Angiopoietin-5 | Angiopoietin-like 3 | Angiopoietin-related protein 3 | FHBL2 | Angiopoietin 5 | Angiopoietin-like protein 3 | ANGPTL3
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9Y5C1
NCBI GenBank: NM_014495 | NP_055310.1
SwissProt: Q9Y5C1

Target

Target: Human ANGPTL3
Antigen Species: Human
Gene Name: ANGPTL3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN from the human protein were used as the immunogen for the ANGPTL3 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS