
IHC testing of human pancreatic cancer tissue with Alpha Amylase antibody at 0.5ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
AMY1A / Salivary Amylase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781943-100
Catalog Number: LS-C781943
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Salivary Amylase antibody LS-C781943 is an unconjugated rabbit polyclonal antibody to Salivary Amylase (AMY1A) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Alpha-amylase 1 | AMY1A | Glycogenase | AMY1 | Amylase, alpha 1A (salivary) | Amylase, alpha 1A salivary | Amylase, salivary, alpha-1A | Salivary amylase alpha 1A | Salivary alpha-amylase | Salivary Amylase
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P04745
- NCBI GenBank
- NM_004038 | NP_004029.2
- SwissProt
- P04745
Target
- Target
- Human AMY1A / Salivary Amylase
- Antigen Species
- Human
- Gene Name
- AMY1A|AMY1B|AMY1C
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
