RUNX1/AML1 antibody , . All lanes: Anti RUNX1 at 0.5 ug/ml. WB: Recombinant Human RUNX1 Protein 0.5ng. Predicted band size: 50 kD. Observed band size: 50 kD.
AML1 / RUNX1 Antibody (aa200-233)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Hamster, Horse, Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C344016-100
Catalog Number: LS-C344016
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RUNX1 antibody LS-C344016 is an unconjugated rabbit polyclonal antibody to RUNX1 (AML1) (aa200-233) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Ham, Hr, Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMLCR1 | Aml1 oncogene | AML1 | AML1-EVI-1 | CBF-alpha-2 | CBFA2 | Acute myeloid leukemia 1 | EVI-1 | PEBP2A2 | PEA2-alpha B | AML1-EVI-1 fusion protein | Oncogene AML-1 | PEBP2-alpha B | PEBP2aB | RUNX1
- UniProt Number
- Q01196
- NCBI GenBank
- NM_001754 | NP_001745.2
- SwissProt
- Q01196
Target
- Target
- Human AML1 / RUNX1
- Antigen Species
- Human
- Epitope
- Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
- Gene Name
- RUNX1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233 aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl