Western blot testing of 1) rat skeletal muscle, 2) human HeLa and 3) human MCF7 lysate with AMHR2 antibody at 0.5ug/ml. Predicted molecular weight: ~63 kDa.
AMHR2 / MISRII Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781803-100
Catalog Number: LS-C781803
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MISRII antibody LS-C781803 is an unconjugated rabbit polyclonal antibody to MISRII (AMHR2) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMH type II receptor | AMHR | MIS type II receptor | MISR2 | AMHR2 | MISRII | MRII
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q16671
- NCBI GenBank
- NM_020547 | NP_065434.1
- SwissProt
- Q16671
Target
- Target
- Human AMHR2 / MISRII
- Antigen Species
- Human
- Gene Name
- AMHR2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS