AMH / Anti-Mullerian Hormone Antibody (clone 5/6, Supernatant)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Liquid |
$897.00each
Catalog Number: LS-C188251-1
Catalog Number: LS-C188251
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Anti-Mullerian Hormone antibody LS-C188251 is an unconjugated mouse monoclonal antibody to human Anti-Mullerian Hormone (AMH). Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- AMH | Anti-Muellerian hormone | Anti-Mullerian hormone | Muellerian-inhibiting factor | Mullerian inhibiting factor | Mullerian inhibiting substance | MIS
- Recommended Dilution: IHC-P
- 1:20 - 1:40
- UniProt Number
- P03971
- NCBI GenBank
- NM_000479 | NP_000470.2
- SwissProt
- P03971
Target
- Target
- Human AMH / Anti-Mullerian Hormone
- Antigen Species
- Human
- Epitope
- Is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. Plays a role in testicular differentiation and in the regulation of ovarian follicle growth. Is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
- Gene Name
- AMH
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- 5/6
- Isotype
- IgG1
Immunogen
- Immunogen
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Pig (100%); Panda, Dog, Bovine (97%); Rat, Guinea pig (94%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- 0.1% Sodium Azide
- Volume
- 1 Milliliter
- Preservative
- Yes
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate.