Western blot - Anti-AMACR/P504S Picoband Antibody
AMACR / P504S Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662453-100
Catalog Number: LS-C662453
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P504S antibody LS-C662453 is an unconjugated rabbit polyclonal antibody to human P504S (AMACR). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 2-methylacyl-CoA racemase | AMACRD | Alpha-methylacyl-CoA racemase | CBAS4 | RACE | AMACR | RM | AMACR/p504S
- UniProt Number
- Q9UHK6
- NCBI GenBank
- NM_014324 | NP_055139.4
- SwissProt
- Q9UHK6
Target
- Target
- Human AMACR / P504S
- Antigen Species
- Human
- Gene Name
- AMACR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246 aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl