Western blot testing of 1) rat spleen, 2) mouse spleen and 3) human COLO320 lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.
ALOX12 / 12 Lipoxygenase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782971-100
Catalog Number: LS-C782971
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 12 Lipoxygenase antibody LS-C782971 is an unconjugated rabbit polyclonal antibody to 12 Lipoxygenase (ALOX12) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 12S-lipoxygenase | 12-lipoxygenase | 12S-LOX | 12(S)-lipoxygenase | 12-LOX | 12 Lipoxygenase | ALOX12 | Arachidonate 12-lipoxygenase | LOG12 | Platelet 12-LOX | Platelet-type 12-lipoxygenase | Platelet-type lipoxygenase 12
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P18054
- NCBI GenBank
- NM_000697 | NP_000688.2
- SwissProt
- P18054
Target
- Target
- Human ALOX12 / 12 Lipoxygenase
- Antigen Species
- Human
- Gene Name
- ALOX12
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS