Western blot - Anti-12 Lipoxygenase Picoband Antibody
ALOX12 / 12 Lipoxygenase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662147-100
Catalog Number: LS-C662147
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 12 Lipoxygenase antibody LS-C662147 is an unconjugated rabbit polyclonal antibody to human 12 Lipoxygenase (ALOX12). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 12S-lipoxygenase | 12-lipoxygenase | 12S-LOX | 12(S)-lipoxygenase | 12-LOX | 12 Lipoxygenase | ALOX12 | Arachidonate 12-lipoxygenase | LOG12 | Platelet 12-LOX | Platelet-type 12-lipoxygenase | Platelet-type lipoxygenase 12
- UniProt Number
- P18054
- NCBI GenBank
- NM_000697 | NP_000688.2
- SwissProt
- P18054
Target
- Target
- Human ALOX12 / 12 Lipoxygenase
- Antigen Species
- Human
- Epitope
- Expressed in vascular smooth muscle cells. .
- Gene Name
- ALOX12
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human 12 Lipoxygenase (186-231 aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl