Western blot analysis of extracts of various cell lines, using ALDH3B1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

ALDH3B1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497123-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ALDH3B1 antibody LS-C497123 is an unconjugated rabbit polyclonal antibody to ALDH3B1 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Aldehyde dehydrogenase 3B1 | ALDH3B1 | Aldehyde dehydrogenase 7 | ALDH7 | ALDH4
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P43353
NCBI GenBank: NM_000694 | NP_000685.1
SwissProt: P43353

Target

Target: Human ALDH3B1
Antigen Species: Human
Gene Name: ALDH3B1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1). MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYP
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)