ALDH2 antibody Western blot. All lanes: Anti ALDH2 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Predicted band size: 56 kD. Observed band size: 56 kD.

ALDH2 Antibody (aa18-48)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407685-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ALDH2 antibody LS-C407685 is an unconjugated rabbit polyclonal antibody to ALDH2 (aa18-48) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Acetaldehyde dehydrogenase 2 | ALDH-E2 | ALDH2 | ALDH class 2 | ALDHI | ALDM | Liver mitochondrial ALDH
UniProt Number: P05091
NCBI GenBank: NM_000690 | NP_000681.2
SwissProt: P05091

Target

Target: Human ALDH2
Antigen Species: Human
Gene Name: ALDH2

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human ALDH2 (18-48 aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl