Western blot - Anti-AKR1B10 Picoband Antibody

AKR1B10 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662177-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: AKR1B10 antibody LS-C662177 is an unconjugated rabbit polyclonal antibody to human AKR1B10. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: AKR1B10 | AKR1B11 | Aldose reductase-like peptide | ALDRLn | AKR1B12 | Aldose reductase-like | Aldose reductase-like 1 | ARP | HARP | HSI | Small intestine reductase | ARL-1 | SI reductase
UniProt Number: O60218
NCBI GenBank: NM_020299 | NP_064695.3
SwissProt: O60218

Target: Human AKR1B10
Antigen Species: Human
Epitope: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
Gene Name: AKR1B10

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human AKR1B10 (285-316 aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl