Western blot - Anti-Adenylate Kinase 1 Picoband Antibody
AK1 / Adenylate Kinase 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662317-100
Catalog Number: LS-C662317
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Adenylate Kinase 1 antibody LS-C662317 is an unconjugated rabbit polyclonal antibody to human Adenylate Kinase 1 (AK1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AK1 | Adenylate kinase isoenzyme 1 | Adenylate kinase 1 | AK 1 | ATP-AMP transphosphorylase 1 | Myokinase
- UniProt Number
- P00568
- NCBI GenBank
- NM_000476 | NP_000467.1
- SwissProt
- P00568
Target
- Target
- Human AK1 / Adenylate Kinase 1
- Antigen Species
- Human
- Gene Name
- AK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human AK1 (149-189 aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl