AIF antibody Western blot. All lanes: Anti AIF at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Stomach Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: U87 Whole Cell Lysate at 40 ug. Lane 7: PANC Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 85 kD.
AIFM1 / AIF / PDCD8 Antibody (aa582-613)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Hamster, Horse, Human, Mammal (Other), Mouse, Non-Human Primate, Pig, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357554-100
Catalog Number: LS-C357554
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PDCD8 antibody LS-C357554 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa582-613) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB.
- Application
- ICC, IHC, IHC-P, WB
- Reactivity
- Bov, Ham, Hr, Hu, Mml, Ms, NHP, Por, Rb, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AIF | AIFM1 | COXPD6 | PDCD8 | Programmed cell death 8
- UniProt Number
- O95831
- NCBI GenBank
- NM_004208, NP_004199.1
- SwissProt
- O95831
Target
- Target
- Human AIFM1 / AIF / PDCD8
- Antigen Species
- Hu
- Epitope
- Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .
- Gene Name
- AIFM1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human AIF(582-613 aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl