
IHC testing of FFPE human lung cancer tissue with IBA1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
AIF1 / IBA1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781983-100
Catalog Number: LS-C781983
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IBA1 antibody LS-C781983 is an unconjugated rabbit polyclonal antibody to human IBA1 (AIF1). Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AIF-1 | AIF1 | Em:AF129756.17 | G1 | IRT-1 | Protein G1 | IBA1 | IRT1
- UniProt Number
- P55008
- NCBI GenBank
- NM_004847 | NP_004838.1
- SwissProt
- P55008
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human AIF1 / IBA1
- Antigen Species
- Human
- Gene Name
- AIF1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
