AICDA / AID Antibody (Biotin)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general) |
| Reactivity: | Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Format: | Liquid |
$479.00each
Catalog Number: LS-C761216-100
Catalog Number: LS-C761216
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AID antibody LS-C761216 is a biotin-conjugated rabbit polyclonal antibody to AID (AICDA) from human. It is reactive with human, mouse, rat and other species. Validated for IHC.
- Application
- IHC
- Reactivity
- Can, Hr, Hu, Ms, Por, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AICDA | AID | ARP2 | CDA2 | Cytidine aminohydrolase | HIGM2
- UniProt Number
- Q9GZX7
- NCBI GenBank
- NM_020661 | NP_065712.1
- SwissProt
- Q9GZX7
Target
- Target
- Human AICDA / AID
- Antigen Species
- Human
- Gene Name
- AICDA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Biotin
- Format
- Liquid
- Formulation
- PBS, 0.09% sodium azide, 2% sucrose
- Volume
- 100 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS