AHSG antibody Western blot. All lanes: Anti AHSG at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 39 kD. Observed band size: 39 kD, 58 kD.
AHSG / Fetuin A Antibody (aa33-65)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407781-100
Catalog Number: LS-C407781
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fetuin A antibody LS-C407781 is an unconjugated rabbit polyclonal antibody to Fetuin A (AHSG) (aa33-65) from human. It is reactive with human and rat. Validated for ELISA, IHC and WB.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- A2HS | Alpha-2-Z-globulin | Fetuin | Fetuin-A | AHS | AHSG | Alpha-2-HS-glycoprotein | Ba-alpha-2-glycoprotein | FETUA | HSGA
- UniProt Number
- P02765
- NCBI GenBank
- NM_001622 | NP_001613.2
- SwissProt
- P02765
Recommended Dilution
| Application | Dilution |
|---|---|
| ELISA | 0.1 - 0.5 ug/ml |
Target
- Target
- Human AHSG / Fetuin A
- Antigen Species
- Human
- Epitope
- Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
- Gene Name
- AHSG
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Fetuin A (33-65 aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl