Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Flow Cytometry analysis of U87 cells using anti-AHR antibody. Overlay histogram showing U87 cells stained with anti-AHR antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-AHR Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
AHR Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Frozen, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756379-100
Catalog Number: LS-C756379
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AHR antibody LS-C756379 is an unconjugated rabbit polyclonal antibody to AHR from human. It is reactive with human, mouse and rat. Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC-F, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Ah receptor | AH-receptor | Aryl hydrocarbon receptor | BHLHe76 | AHR | Aromatic hydrocarbon receptor
- UniProt Number
- P35869
- NCBI GenBank
- NM_001621 | NP_001612.1
- SwissProt
- P35869
Recommended Dilution
| Application | Dilution |
|---|---|
| FC | 1 - 3 µg/10E6 cells |
| IF/ICC | 0.5 - 1 µg/ml |
| IHC-F | 0.5 - 1 µg/ml |
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human AHR
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- AHR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
