Western blot testing of 1) rat thymus and 2) human 22RV1 lysate with AGO4 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa, observed here at ~115 kDa.
AGO4 / EIF2C4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781797-100
Catalog Number: LS-C781797
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EIF2C4 antibody LS-C781797 is an unconjugated rabbit polyclonal antibody to EIF2C4 (AGO4) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Argonaute4 | AGO4 | EIF2C4 | EIF2C 4 | HAgo4 | KIAA1567 | Protein argonaute-4 | Argonaute 4 | EIF-2C 4
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q9HCK5
- NCBI GenBank
- NM_017629 | NP_060099.2
- SwissProt
- Q9HCK5
Target
- Target
- Human AGO4 / EIF2C4
- Antigen Species
- Human
- Gene Name
- AGO4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD from the human protein were used as the immunogen for the AGO4 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS