
Western blot testing of 1) rat brain, 2) mouse brain and 3) HeLa lysate with AGO2 antibody at 0.5ug/ml. Expected molecular weight ~97 kDa.
AGO2 / EIF2C2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781796-100
Catalog Number: LS-C781796
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EIF2C2 antibody LS-C781796 is an unconjugated rabbit polyclonal antibody to EIF2C2 (AGO2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AGO2 | Argonaute2 | Argonaute 2 | EIF-2C 2 | EIF2C2 | EIF2C 2 | HAgo2 | PPD | Protein slicer | Q10 | PAZ Piwi domain protein | Protein argonaute-2
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human AGO2 / EIF2C2
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
