Western blot - Anti-Ago2/eIF2C2 Picoband Antibody
AGO2 / EIF2C2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662447-100
Catalog Number: LS-C662447
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EIF2C2 antibody LS-C662447 is an unconjugated rabbit polyclonal antibody to human EIF2C2 (AGO2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AGO2 | Argonaute2 | Argonaute 2 | EIF-2C 2 | EIF2C2 | EIF2C 2 | HAgo2 | PPD | Protein slicer | Q10 | PAZ Piwi domain protein | Protein argonaute-2
Target
- Target
- Human AGO2 / EIF2C2
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Ago2/ eIF2C2 (129-169 aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl