RAGE antibody Western blot. All lanes: Anti RAGE at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: RH35 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
AGER / RAGE Antibody (aa91-120)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407683-100
Catalog Number: LS-C407683
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RAGE antibody LS-C407683 is an unconjugated rabbit polyclonal antibody to RAGE (AGER) (aa91-120) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AGER | RAGE | RAGE isoform NtRAGE-delta | RAGE isoform sRAGE-delta
- UniProt Number
- Q15109
- NCBI GenBank
- NM_001136 | NP_001127.1
- SwissProt
- Q15109
Target
- Target
- Human AGER / RAGE
- Antigen Species
- Human
- Epitope
- Endothelial cells.
- Gene Name
- AGER
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human RAGE (91-120 aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl