
Western blot testing of 1) rat spleen, 2) rat stomach, 3) mouse lung, 4) mouse liver and 5) mouse pancreas lysate wtih GRK2 antibody at 0.5ug/ml. Predicted molecular weight ~79 kDa.
ADRBK1 / GRK2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782064-100
Catalog Number: LS-C782064
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GRK2 antibody LS-C782064 is an unconjugated rabbit polyclonal antibody to GRK2 (ADRBK1) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADRBK1 | BARK1 | Beta-ARK-1 | BETA-ARK1 | BARK | Betaark1 | GRK2
- UniProt Number
- P25098
- NCBI GenBank
- NM_001619 | NP_001610.2
- SwissProt
- P25098
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Mouse ADRBK1 / GRK2
- Antigen Species
- Mouse
- Gene Name
- GRK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK from the human protein were used as the immunogen for the GRK2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
