
Western blot analysis of GRK2 using anti-GRK2 antibody
ADRBK1 / GRK2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662968-100
Catalog Number: LS-C662968
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GRK2 antibody LS-C662968 is an unconjugated rabbit polyclonal antibody to human GRK2 (ADRBK1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADRBK1 | BARK1 | Beta-ARK-1 | BETA-ARK1 | BARK | Betaark1 | GRK2
- UniProt Number
- P25098
- NCBI GenBank
- NM_001619 | NP_001610.2
- SwissProt
- P25098
Target
- Target
- Human ADRBK1 / GRK2
- Antigen Species
- Human
- Epitope
- Expressed in peripheral blood leukocytes.
- Gene Name
- GRK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
