ADRB2
Catalog Number: LS-C100823-400
400 µL / $401.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity: Human, Mouse
Format: Liquid
Western blot analysis of extracts of various cell lines.
ADRB2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331855-20
Catalog Number: LS-C331855
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ADRB2 antibody LS-C331855 is an unconjugated rabbit polyclonal antibody to ADRB2 from human. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADRB2R | ADRB2 | Adrenoceptor beta 2, surface | ADRBR | B2AR | Beta-2 adrenoceptor | Beta-2 adrenergic receptor | Beta-2 adrenoreceptor | BETA2AR | BAR | Adrenergic beta-2 receptor | Catecholamine receptor
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P07550
- NCBI GenBank
- NM_000024, NP_000015.1
- SwissProt
- P07550
Target
- Target
- Human ADRB2
- Antigen Species
- Hu
- Epitope
- Human ADRB2
- Gene Name
- ADRB2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1). IAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
