Western blot analysis of extracts of various cell lines.

ADRB2 Antibody

Name: ADRB2 Antibody
Brand: LSBio
SKU: LS-C331855-20
Price: 281 USD
Availability: InStock

$281.00each

Catalog Number: LS-C331855-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ADRB2 antibody LS-C331855 is an unconjugated rabbit polyclonal antibody to ADRB2 from human. It is reactive with mouse and rat. Validated for WB.
Application: WB
Reactivity: Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ADRB2R | ADRB2 | Adrenoceptor beta 2, surface | ADRBR | B2AR | Beta-2 adrenoceptor | Beta-2 adrenergic receptor | Beta-2 adrenoreceptor | BETA2AR | BAR | Adrenergic beta-2 receptor | Catecholamine receptor
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P07550
NCBI GenBank: NM_000024 | NP_000015.1
SwissProt: P07550

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1). IAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)