Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
ADRA1A antibody Western blot. All lanes: Anti ADRA1A at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Lung Tissue Lysate at 50 ug. Lane 6: 22RV1 Whole Cell Lysate at 40 ug. Lane 7: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 51 kD. Observed band size: 51 kD.
ADRA1A Antibody (aa335-373)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407964-100
Catalog Number: LS-C407964
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ADRA1A antibody LS-C407964 is an unconjugated rabbit polyclonal antibody to ADRA1A (aa335-373) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | ADRA1A | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR
- UniProt Number
- P35348
- NCBI GenBank
- BAA04960.1 | NM_000680
- SwissProt
- P35348
Target
- Target
- Human ADRA1A
- Antigen Species
- Human
- Epitope
- Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart. .
- Gene Name
- ADRA1A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ADRA1A (335-373 aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
