Western blot analysis of extracts of various cells.
ADCY3 / Adenylate Cyclase 3 Antibody (Cy3)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409419-20
Catalog Number: LS-C409419
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Adenylate Cyclase 3 antibody LS-C409419 is a Cy3-conjugated rabbit polyclonal antibody to Adenylate Cyclase 3 (ADCY3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AC-III | AcIII | Adenylyl cyclase 3 | AC3 | Adenylate cyclase type III | ATP pyrophosphate-lyase 3 | ADCY3 | Adenylate cyclase 3 | Adenylate cyclase type 3 | Adenylyl cyclase, type III | KIAA0511
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- O60266
- NCBI GenBank
- NM_004036 | NP_004027.2
- SwissProt
- O60266
Target
- Target
- Human ADCY3 / Adenylate Cyclase 3
- Antigen Species
- Human
- Epitope
- Human ADCY3 / Adenylate Cyclase 3
- Gene Name
- ADCY3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Cyanine 3
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS