Western blot testing of 1) rat testis, 2) mouse testis and 3) MCF7 lysate with ADAM2 antibody at 0.5ug/ml. Predicted molecular weight ~82 kDa, but can be observed at ~100 kDa.
ADAM2 / Fertilin Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782012-100
Catalog Number: LS-C782012
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fertilin Beta antibody LS-C782012 is an unconjugated rabbit polyclonal antibody to Fertilin Beta (ADAM2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADAM2 | ADAM 2 | CRYN1 | CRYN2 | CT15 | ADAM metallopeptidase domain 2 | FTNB | Fertilin | Fertilin beta | Fertilin subunit beta | PH-30 | PH-30b | PH30 | PH30-beta | Cancer/testis antigen 15
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q99965
- NCBI GenBank
- NM_001464 | NP_001455.3
- SwissProt
- Q99965
Target
- Target
- Human ADAM2 / Fertilin Beta
- Antigen Species
- Human
- Gene Name
- ADAM2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS