Western blot - Anti-ADAM2 Picoband Antibody
ADAM2 / Fertilin Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662265-100
Catalog Number: LS-C662265
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fertilin Beta antibody LS-C662265 is an unconjugated rabbit polyclonal antibody to human Fertilin Beta (ADAM2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADAM2 | ADAM 2 | CRYN1 | CRYN2 | CT15 | ADAM metallopeptidase domain 2 | FTNB | Fertilin | Fertilin beta | Fertilin subunit beta | PH-30 | PH-30b | PH30 | PH30-beta | Cancer/testis antigen 15
- UniProt Number
- Q99965
- NCBI GenBank
- NM_001464 | NP_001455.3
- SwissProt
- Q99965
Target
- Target
- Human ADAM2 / Fertilin Beta
- Antigen Species
- Human
- Epitope
- Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
- Gene Name
- ADAM2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ADAM2 (231-274 aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl