Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Flow Cytometry analysis of Hela cells using anti-Human ACTN3 antibody. Overlay histogram showing Hela cells stained with anti-Human ACTN3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human ACTN3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ACTN3 Antibody (DY488)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756561-203
Catalog Number: LS-C756561
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACTN3 antibody LS-C756561 is a DY488-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Actinin, alpha 3 | Alpha-actinin skeletal muscle | Alpha-actinin-3 | ACTN3 | F-actin cross-linking protein
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- Q08043
- NCBI GenBank
- NM_001104, NP_001095.2
- SwissProt
- Q08043
Target
- Target
- Human ACTN3
- Antigen Species
- Hu
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- ACTN3
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- DL488
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl
