Western blot testing of 1) rat brain and 2) mouse brain lysate with ACSL5 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.
ACS5 / ACSL5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782824-100
Catalog Number: LS-C782824
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACSL5 antibody LS-C782824 is an unconjugated rabbit polyclonal antibody to ACSL5 (ACS5) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACS2 | ACSL5 | ACS5 | FACL5 | Fatty acid coenzyme A ligase 5 | Phosphatidylinositol 4-kinase | LACS 5
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q9ULC5
- NCBI GenBank
- NM_016234 | NP_057318.2
- SwissProt
- Q9ULC5
Target
- Target
- Mouse ACS5 / ACSL5
- Antigen Species
- Mouse
- Gene Name
- ACSL5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 337-378 (ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA) from the human protein were used as the immunogen for the ACSL5 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS