Western blot - Anti-ACSL5 Picoband Antibody
ACS5 / ACSL5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662232-100
Catalog Number: LS-C662232
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACSL5 antibody LS-C662232 is an unconjugated rabbit polyclonal antibody to human ACSL5 (ACS5). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACS2 | ACSL5 | ACS5 | FACL5 | Fatty acid coenzyme A ligase 5 | Phosphatidylinositol 4-kinase | LACS 5
- UniProt Number
- Q9ULC5
- NCBI GenBank
- NM_016234 | NP_057318.2
- SwissProt
- Q9ULC5
Target
- Target
- Human ACS5 / ACSL5
- Antigen Species
- Human
- Gene Name
- ACSL5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378 aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl