Western blot testing of 1) mouse lung, 2) mouse testis, 3) mouse stomach and 4) rat lung tissue lysate with Ace antibody at 0.5ug/ml. Expected molecular weight 140-170 kDa.
ACE / CD143 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782051-100
Catalog Number: LS-C782051
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD143 antibody LS-C782051 is an unconjugated rabbit polyclonal antibody to CD143 (ACE) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACE | ACE1 | Angiotensin-converting enzyme | CD143 | CD143 antigen | Carboxycathepsin | DIPEPTIDYL CARBOXYPEPTIDASE | DCP | Dipeptidyl carboxypeptidase I | ICH | Kininase II | MVCD3 | Peptidyl-dipeptidase A | Peptidase P | DCP1 | Dipeptidyl carboxypeptidase 1 | Testicular ECA
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P12821
- NCBI GenBank
- NM_000789 | NP_000780.1
- SwissProt
- P12821
Target
- Target
- Mouse ACE / CD143
- Antigen Species
- Mouse
- Gene Name
- ACE
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS