Western blot - Anti-Ace/Cd143 Picoband antibody
ACE / CD143 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662617-100
Catalog Number: LS-C662617
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD143 antibody LS-C662617 is an unconjugated rabbit polyclonal antibody to human CD143 (ACE). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACE | ACE1 | Angiotensin-converting enzyme | CD143 | CD143 antigen | Carboxycathepsin | DIPEPTIDYL CARBOXYPEPTIDASE | DCP | Dipeptidyl carboxypeptidase I | ICH | Kininase II | MVCD3 | Peptidyl-dipeptidase A | Peptidase P | DCP1 | Dipeptidyl carboxypeptidase 1 | Testicular ECA
- UniProt Number
- P12821
- NCBI GenBank
- NM_000789 | NP_000780.1
- SwissProt
- P12821
Target
- Target
- Human ACE / CD143
- Antigen Species
- Human
- Epitope
- Testis-specific isoform is expressed in spermatocytes, adult testis.
- Gene Name
- ACE
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl