Western blot testing of 1) rat lung, 2) mouse brain and 3) human HeLa lysate with ACAA2 antibody at 0.5ug/ml. Predicted molecular weight ~42 kDa.

ACAA2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C781823-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ACAA2 antibody LS-C781823 is an unconjugated rabbit polyclonal antibody to ACAA2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Acetyl-CoA acyltransferase 2 | ACAA2 | Acetyl-CoA acyltransferase | Beta-ketothiolase | DSAEC | Beta ketothiolase
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P42765
NCBI GenBank: NM_006111 | NP_006102.2
SwissProt: P42765

Immunogen: aa 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD) from the human protein for the ACAA2 antibody.

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS