Western blot - Anti-ABR Picoband Antibody

ABR Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662444-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ABR antibody LS-C662444 is an unconjugated rabbit polyclonal antibody to human ABR. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ABR | Active BCR-related | Active BCR-related gene | MDB
UniProt Number: Q12979
NCBI GenBank: NM_021962 | NP_068781.2
SwissProt: Q12979

Target: Human ABR
Antigen Species: Human
Epitope: Highly enriched in the brain. Much weaker expression in heart, lung and muscle.
Gene Name: ABR

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407 aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl