Western blot testing of 1) human placenta, 2) rat brain and 3) mouse brain lysate with SUR1 antibody at 0.5ug/ml. Predicted molecular weight ~177 kDa.
ABCC8 / SUR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782057-100
Catalog Number: LS-C782057
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SUR1 antibody LS-C782057 is an unconjugated rabbit polyclonal antibody to SUR1 (ABCC8) from human. It is reactive with human, mouse and rat. Validated for Flow and WB.
- Application
- FC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABC36 | ABCC8 | HI | PHHI | Sulfonylurea receptor | SUR | Sulfonylurea receptor 1 | MRP8 | SUR1delta2 | HHF1 | HRINS | SUR1 | TNDM2
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q09428
- NCBI GenBank
- NM_000352 | NP_000343.2
- SwissProt
- Q09428
Target
- Target
- Human ABCC8 / SUR1
- Antigen Species
- Human
- Gene Name
- ABCC8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS