
ABCC8 / SUR1 Antibody (DY550)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756432-134
Catalog Number: LS-C756432
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SUR1 antibody LS-C756432 is a DY550-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABC36 | ABCC8 | HI | PHHI | Sulfonylurea receptor | SUR | Sulfonylurea receptor 1 | MRP8 | SUR1delta2 | HHF1 | HRINS | SUR1 | TNDM2
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- Q09428
- NCBI GenBank
- NM_000352 | NP_000343.2
- SwissProt
- Q09428
Target
- Target
- Human ABCC8 / SUR1
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- ABCC8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- DyLight 550
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl
