TAP1 antibody Western blot. All lanes: Anti TAP1 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: HUT Whole Cell Lysate at 40 ug. Lane 3: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 87 kD. Observed band size: 87 kD.
ABCB2 / TAP1 Antibody (aa438-471)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408034-100
Catalog Number: LS-C408034
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TAP1 antibody LS-C408034 is an unconjugated rabbit polyclonal antibody to human TAP1 (ABCB2) (aa438-471). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABC17 | ABCB2 | APT1 | D6S114E | ABC transporter, MHC 1 | Ham1 | Peptide transporter TAP1 | PSF1 | TAP1 | TAP1N | MTP1 | Peptide transporter PSF1 | PSF-1 | Peptide supply factor 1 | RING4 | Y3
- UniProt Number
- Q03518
- NCBI GenBank
- NM_000593 | NP_000584.2
- SwissProt
- Q03518
Target
- Target
- Human ABCB2 / TAP1
- Antigen Species
- Human
- Gene Name
- TAP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471 aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl