Western blot testing of human 1) THP-1 and 2) A375 cell lysate with P Glycoprotein antibody at 0.5ug/ml. Expected molecular weight: 141-180 kDa depending on glycosylation level.
ABCB1 / MDR1 / P Glycoprotein Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782184-100
Catalog Number: LS-C782184
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P Glycoprotein antibody LS-C782184 is an unconjugated rabbit polyclonal antibody to human P Glycoprotein (ABCB1 / MDR1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABC20 | ABCB1 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P08183
- NCBI GenBank
- NM_000927 | NP_000918.2
- SwissProt
- P08183
Target
- Target
- Human ABCB1 / MDR1 / P Glycoprotein
- Antigen Species
- Human
- Gene Name
- ABCB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY were used as the immunogen for the P Glycoprotein antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Protein A Affinity
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS