P Glycoprotein antibody IHC-frozen: Mouse Intestine Tissue.
ABCB1 / MDR1 / P Glycoprotein Antibody (aa621-650)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Frozen, Immunohistochemistry, Paraffin |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357450-100
Catalog Number: LS-C357450
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P Glycoprotein antibody LS-C357450 is an unconjugated rabbit polyclonal antibody to P Glycoprotein (ABCB1 / MDR1) (aa621-650) from human. It is reactive with human, mouse, rat and other species. Validated for IHC.
- Application
- IHC, IHC-F, IHC-P
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABC20 | ABCB1 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1
- UniProt Number
- P08183
- NCBI GenBank
- NM_000927 | NP_000918.2
- SwissProt
- P08183
Target
- Target
- Human ABCB1 / MDR1 / P Glycoprotein
- Antigen Species
- Human
- Epitope
- Expressed in liver, kidney, small intestine and brain.
- Gene Name
- ABCB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650 aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Thimerosal, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl