Western blot - Anti-ABCA4 Picoband Antibody

ABCA4 Antibody

Name: ABCA4 Antibody
Brand: LSBio
SKU: LS-C662052-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C662052-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ABCA4 antibody LS-C662052 is an unconjugated rabbit polyclonal antibody to human ABCA4. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ABCR | ABC10 | ARMD2 | CORD3 | ABCA4 | FFM | RIM ABC transporter | RIM protein | RMP | RP19 | STGD | Photoreceptor rim protein | Stargardt disease protein | STGD1
UniProt Number: P78363
NCBI GenBank: NM_000350 | NP_000341.2
SwissProt: P78363

Target: Human ABCA4
Antigen Species: Human
Epitope: Retinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells.
Gene Name: ABCA4

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human ABCA4 (1890-1927 aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl