Western blot analysis of extracts of various cell lines, using SRD5A1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

5-Alpha Reductase / SRD5A1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

See all Human 5-Alpha Reductase / SRD5A1 antibodies â†’

$281.00each

Catalog Number: LS-C749770-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SRD5A1 antibody LS-C749770 is an unconjugated rabbit polyclonal antibody to SRD5A1 (5-Alpha Reductase) from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 5-alpha reductase | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase 1 | S5AR 1
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P18405
NCBI GenBank: NM_001047 | NP_001038.1
SwissProt: P18405

Target

Target: Human 5-Alpha Reductase / SRD5A1
Antigen Species: Human
Gene Name: SRD5A1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1). LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF
Immunogen Type: Synthetic Peptide (Linear)