ZNF581 Antibody
Catalog Number: LS-C830696
4 sizes / from $260.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general)
Reactivity: Human
Format: Liquid
Western blot analysis of extracts of various cell lines, using ZNF581 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
Polyclonal Rabbit anti-Human ZNF581 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C748226-20
Catalog Number: LS-C748226
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ZNF581 antibody LS-C748226 is an unconjugated rabbit polyclonal antibody to ZNF581 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HSPC189 | ZNF581 | Zinc finger protein 581
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:1000 - 1:2000
- UniProt Number
- Q9P0T4
- NCBI GenBank
- NM_016535, NP_057619.1
- SwissProt
- Q9P0T4
Target
- Target
- Human ZNF581
- Antigen Species
- Hu
- Gene Name
- ZNF581
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1). MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
