Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C410098-20 20 µl $275 
LS-C410098-50 50 µl (4.19 mg/ml) $311 
LS-C410098-100 100 µl $389 
LS-C410098-200 200 µl $503 
VR1 / TRPV1 Antibody - Western blot analysis of extracts of various cell lines.

Polyclonal Rabbit anti‑Human VR1 / TRPV1 Antibody (WB) LS‑C410098

Polyclonal Rabbit anti‑Human VR1 / TRPV1 Antibody (WB) LS‑C410098

Antibody:
VR1 / TRPV1 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C410098-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
VR1 / TRPV1 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
TRPV1 antibody LS-C410098 is an unconjugated rabbit polyclonal antibody to TRPV1 (VR1) from human. It is reactive with human, mouse and rat. Validated for WB.
Target
Human VR1 / TRPV1
Synonyms
TRPV1 | Capsaicin receptor | OTRPC1 | Vanilloid receptor subtype 1 | Osm-9-like TRP channel 1 | Vanilloid receptor 1 | VR1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPV1 (NP_061197.4). IAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFLVYCLYMIIFTMAAYYRPVDGLPPFKMEKTGDYFRVTGEILSVLGGVYFFFRGIQYFLQRR
Specificity
Human VR1 / TRPV1
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 94kDa, while the observed MW by Western blot was 112kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About VR1 / TRPV1
Q8NER1 NM_018727 NP_061197.4

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/21/2024