Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Villin antibody Western blot. All lanes: Anti Villin at 0.5 ug/ml. Lane 1: Rat Intestine Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: RH35 Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 93 kD. Observed band size: 93 kD.
Polyclonal Rabbit anti-Human VIL1 / Villin Antibody (aa770-799, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407669-100
Catalog Number: LS-C407669
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Villin antibody LS-C407669 is an unconjugated rabbit polyclonal antibody to Villin (VIL1) (aa770-799) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 2 publications.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D2S1471 | Villin | Villin 1 | Villin-1 | VIL | VIL1
- UniProt Number
- P09327
- NCBI GenBank
- NM_007127, NP_009058.2
- SwissProt
- P09327
Target
- Target
- Human VIL1 / Villin
- Antigen Species
- Hu
- Epitope
- Specifically expressed in epithelial cells. Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells. Expressed in canalicular microvilli of hepatocytes (at protein level). .
- Gene Name
- VIL1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
Comparison of Different In Vivo Incubation Sites to Produce Tissue-Engineered Small Intestine. Liu Y, Cromeens BP, Wang Y, Fisher K, Johnson J, Chakroff J, Besner GE. Tissue engineering. Part A. 2018 July;4:1138-1147. PubMed: 29383981 PMC: PMC6033308
