
Western blot analysis of extracts of rat skin cells.
UCN2 / SRP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335681-20
Catalog Number: LS-C335681
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SRP antibody LS-C335681 is an unconjugated rabbit polyclonal antibody to SRP (UCN2) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- SRP | Ucn II | UCN-II | UCN2 | UCNI | Urocortin 2 | UR | Urocortin-related peptide | Stresscopin-related peptide | Urocortin II | Urocortin-2 | URP
- UniProt Number
- Q96RP3
- NCBI GenBank
- NM_033199 | NP_149976.1
- SwissProt
- Q96RP3
Recommended Dilution
| Application | Dilution |
|---|---|
| IF/ICC | 1:50 - 1:100 |
| IHC | 1:50 - 1:100 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human UCN2 / SRP
- Antigen Species
- Human
- Epitope
- Human UCN2 / SRP
- Gene Name
- UCN2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
